PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022213P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 294aa    MW: 32743.9 Da    PI: 8.6554
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022213P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
   MELO3C022213P1 14 KGAWTKDEDQRLIDYIRLHGEGCWRTLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding56.27.7e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++Edel+++++ +lG++ W+ Ia +++ gRt++++k++w+++
   MELO3C022213P1  67 RGNFTEDEDELIIRLHSLLGNK-WSVIAGKLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.791961IPR017930Myb domain
SuperFamilySSF466894.67E-2913108IPR009057Homeodomain-like
SMARTSM007172.5E-131363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
CDDcd001672.13E-101661No hitNo description
PROSITE profilePS5129427.57662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2765117IPR009057Homeodomain-like
SMARTSM007174.5E-1766114IPR001005SANT/Myb domain
PfamPF002494.7E-1667111IPR001005SANT/Myb domain
CDDcd001673.13E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKD EDQRLIDYIR LHGEGCWRTL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEDEDELIIR LHSLLGNKWS VIAGKLPGRT DNEIKNYWNT HIKRKLITRG  120
IDPQTHRPLN EPPTAGTALS PRLPYQSHHH HRRHHQHLTP NHSSSSSSSL PNIAELPIVK  180
PANNVHSSDA DEEGSGTTTE MDPPVAAAET MLGVHVKTEV NLELSIGLQP FQGEGVRGGS  240
VLGSSAESRL REERRALVMC LCWQLGWEKG GESCRNCERT YGWFRGSALG SSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29141187110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818890.0LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459665.10.0PREDICTED: transcription repressor MYB6-like
SwissprotQ388512e-92MYB6_ARATH; Transcription repressor MYB6
TrEMBLA0A0A0KXZ41e-179A0A0A0KXZ4_CUCSA; Uncharacterized protein
STRINGPOPTR_0019s11090.14e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.12e-91myb domain protein 6